PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000200243
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family G2-like
Protein Properties Length: 397aa    MW: 43836.3 Da    PI: 5.5907
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000200243genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.14.1e-33271326156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    kpr++W+peLH+rFv+a++qLGG+e+AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  MDP0000200243 271 KPRRCWSPELHRRFVDALQQLGGTEVATPKQIRELMQVEGLTNDEVKSHLQKYRLH 326
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.82E-18269329IPR009057Homeodomain-like
PROSITE profilePS5129411.254270328IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-29270329IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-27271326IPR006447Myb domain, plants
PfamPF002492.1E-8273324IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MELLSLDSSP LFVPKTITDF LAQLAAIKDG SQRSSELDGY VKRLEDEFRK IEVFKRELPL  60
CMLLLKDAIE LLKEEGMRWR RMEERPVVEV FIPLKGNSEE DGGLVSGKEN IDKKNWMSSA  120
QLWNTSINVF DYTKRDSVEL KLTETLLGFA EISYYLGFFS TGNEEDDRSV TENPIEVSNN  180
RAVEGALLAF RGQNELSGFA KPCLKEVKEV SEVPNLCLMT PLMSEALXCS ASANSRTSNG  240
CKGSGSGSGV AGQVKLLNKP QPQQQQQPLR KPRRCWSPEL HRRFVDALQQ LGGTEVATPK  300
QIRELMQVEG LTNDEVKSHL QKYRLHIRKL PPSAAAGQGN ALLMSLDHSG DHSKANNVQS  360
GSPQGPLLAG GFAKCRSTTG GESGNSREAE EDEKSDG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.97160.0bud| fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008354692.10.0PREDICTED: uncharacterized protein LOC103418344 isoform X1
TrEMBLM5WFN30.0M5WFN3_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.13e-54G2-like family protein